#!/usr/local/bin/perl ############################################################################### # $Id: peptideSearch.cgi 4280 2006-01-13 06:02:10Z dcampbel $ # # SBEAMS is Copyright (C) 2000-2008 Institute for Systems Biology # This program is governed by the terms of the GNU General Public License (GPL) # version 2 as published by the Free Software Foundation. It is provided # WITHOUT ANY WARRANTY. See the full description of GPL terms in the # LICENSE file distributed with this software. ############################################################################### ############################################################################### # Get the script set up with everything it will need ############################################################################### use strict; use lib qw (../../lib/perl); use CGI::Carp qw(fatalsToBrowser croak); use Data::Dumper; use SBEAMS::Connection qw($q $log); use SBEAMS::Connection::Settings; use SBEAMS::Connection::Tables; use SBEAMS::Connection::TabMenu; use SBEAMS::Connection::DataTable; use SBEAMS::Glycopeptide; use SBEAMS::Glycopeptide::Settings; use SBEAMS::Glycopeptide::Tables; use SBEAMS::Glycopeptide::Get_glyco_seqs; use SBEAMS::Glycopeptide::Glyco_query; # Global Variables ############################################################################### # my $sbeams = new SBEAMS::Connection; $sbeams->setSBEAMS_SUBDIR($SBEAMS_SUBDIR); my $sbeamsMOD = new SBEAMS::Glycopeptide; $sbeamsMOD->setSBEAMS($sbeams); my $glyco_query_o = new SBEAMS::Glycopeptide::Glyco_query; $glyco_query_o->setSBEAMS($sbeams); my $predicted_track_type = "Predicted Peptides"; my $id_track_type = 'Identified Peptides'; main(); ############################################################################### # Main Program: # # Call $sbeams->Authentication and stop immediately if authentication # fails else continue. ############################################################################### sub main { my $current_username; #### Do the SBEAMS authentication and exit if a username is not returned exit unless ($current_username = $sbeams->Authenticate( # permitted_work_groups_ref=>['Glycopeptide_user','Glycopeptide_admin', 'Glycopeptide_readonly'], #connect_read_only=>1, allow_anonymous_access=>1, )); #### Read in the default input parameters my %parameters; my $n_params_found = $sbeams->parse_input_parameters( q=>$q, parameters_ref=>\%parameters ); if ( $parameters{unipep_build_id} ) { my $build_id = $sbeamsMOD->get_current_build( build_id => $parameters{unipep_build_id} ); if ( $build_id != $parameters{unipep_build_id} ) { $sbeams->set_page_message( type => 'Error', msg => 'You must log in to access specified build' ); } } ## get project_id to send to HTMLPrinter display my $project_id = $sbeams->getCurrent_project_id(); #### Process generic "state" parameters before we start $sbeams->processStandardParameters(parameters_ref=>\%parameters); #$sbeams->printDebuggingInfo($q); my $content = qq~

In chemistry and biochemistry, a kinase, alternatively known as a phosphotransferase, is a type of enzyme that transfers phosphate groups from high-energy donor molecules, such as ATP, to specific target molecules (substrates); the process is termed phosphorylation1

The kinase regulation data in phosphopep was collected by doing an exhaustive phosophoproteomic analysis of kinase knockout strains from the Sacharomyces genome deletion project 2

~; #### Decide what action to take based on information so far $content .= display_kinases(); $sbeamsMOD->display_page_header(project_id => $project_id); print $sbeams->getGifSpacer(800); print "$content"; print qq~


1 Kinase definition
2 Yeast deletion collection ~; $sbeamsMOD->display_page_footer(); } # end main ############################################################################### # Show the main welcome page ############################################################################### sub handle_request { my %args = @_; my $params = shift; my %params = %{$params}; } sub display_kinases{ my $mode = shift; my $t1 = time(); my $sql =<<" END"; SELECT DISTINCT kinase_name, kinase_knockout_id, protein_name, modified_peptide_sequence FROM glycopeptide.dbo.kinase_knockout ORDER BY kinase_name ASC, protein_name ASC, modified_peptide_sequence END my $sth = $sbeams->get_statement_handle( $sql ); my %kinases; while ( my @row = $sth->fetchrow_array() ) { $kinases{$row[0]} ||= {}; $kinases{$row[0]}->{proteins} ||= {}; $kinases{$row[0]}->{proteins}->{$row[2]}++; $kinases{$row[0]}->{peptides}++; my $sites = $row[3] =~ tr/\*/\*/; $kinases{$row[0]}->{sites} += $sites; } my $t2 = time(); my $elapsed = $t2 - $t1; $log->debug( "Elapsed: $elapsed" ); my $html = ''; my $table = SBEAMS::Connection::DataTable->new( BORDER => 0 ); # $table->addRow( ['Kinase Name', '# regulated proteins', '# peptides', '# phosphosites' ] ); $table->addRow( ['Kinase Name', '# regulated proteins', '# peptides' ] ); $table->setRowAttr( ROWS => [1], BGCOLOR => '#C0D0C0' ); $table->setHeaderAttr( BOLD => 1 ); my $cgi_url = "peptideSearch.cgi?action=Show_detail_form&ipi_data_id"; my $bgcolor = 'E0E0E0'; for my $key (sort( keys(%kinases))) { my $link = "$key"; my $n_prots = scalar( keys( %{$kinases{$key}->{proteins}} ) ); my $n_peps = $kinases{$key}->{peptides}; my $n_sites = $kinases{$key}->{sites}; # $table->addRow( [$link, $n_prots, $n_peps, $n_sites ] ); $table->addRow( [$link, $n_prots, $n_peps ] ); $bgcolor = ( $bgcolor eq '#E0E0E0' ) ? '#F1F1F1' : '#E0E0E0'; $table->setRowAttr( ROWS => [$table->getRowNum()], BGCOLOR => $bgcolor ); } $table->setColAttr( COLS => [1], ROWS => [2..$table->getRowNum()], ALIGN => 'LEFT' ); $table->setColAttr( COLS => [2..3], ROWS => [2..$table->getRowNum()], ALIGN => 'RIGHT' ); return "$table"; } ############################################################################### #nice_term_print #put breaks into long lines ############################################################################### sub nice_term_print{ my $info = shift; my @html = (); my $info = substr($info, 0, 75, '...'); #chop things down to 75 or less my @hold = split /\s/, $info; my $count = 0; foreach my $term(@hold){ if ($count <= 5){ push @html, $term; }else{ $count == 0; push @html, "$term
"; } } return join " ", @html; } ############################################################################### __DATA__ print $q->table({class=>'table_setup'}, $q->Tr({class=>'rev_gray_head'}, $q->td({colspan=>2}, $q->h2("ISB N-glycosylation peptide prediction server")), ), $q->Tr( $q->td({colspan=>2}, "The ISB N-Glyco prediction server shows all the N-linked glycosylation site contained within predicted and identified tryptic peptides. The Glyco score indicates how likely the site is glycosylated and the detection score is an indication on how likely the glycosylated peptide will be detected in a MS/MS run. This is useful for quantitating proteins of interest.
Click here for more information." ) ), $q->Tr( $q->td({colspan=>2},' 

 ') ), $q->Tr({class=>'rev_gray_head'}, $q->td({colspan=>2}, $q->h2("Text Search")) ), $q->Tr( $q->td({class=>'grey_bg'}, "Choose Search option"), $q->td( $q->start_form(), $q->popup_menu(-name=>'search_type', -values=>\@search_types, -default=>['Gene Symbol'], -size=>1, ) ) ), $q->Tr( $q->td({class=>'grey_bg'},'Search Term'), $q->td( $q->textfield(-name=>'search_term', -value=>'', -size=>50, -maxlength=>80) ) ), $q->Tr( $q->td({class=>'blue_bg', colspan=>2}, "Wild Card Searching with '%' at the start and/or end of the Search Term") ), $q->Tr( $q->td({colspan=>2}, "
-- or --

") ), $q->Tr({class=>'rev_gray_head'}, $q->td({colspan=>2}, $q->h2("Sequence Search") ) ), $q->Tr( $q->td({class=>'grey_bg'}, "Search by Protein Sequence"), $q->td( $q->textarea(-name=>'sequence_search', -default=>'', -rows=>10, -columns=>50) ) ), $q->Tr( $q->td({class=>'blue_bg', colspan=>2}, "Sequence search is by perfect match only, no wild cards. Sequences will be truncated at 500 residues.") ), ),#end table $q->submit(), $q->reset(), $q->hidden(-name=>'action', -default=>['Show_hits_form']), $q->endform(); ### add an Example table my $cgi_url = "$base_url?action=Show_hits_form&search_type"; print "

", $q->table( $q->Tr( $q->td({class=>'rev_gray_head', colspan=>2}, $q->h2("Examples")) ), $q->Tr( $q->td({class=>'grey_bg'}, "Gene Name"), $q->td($q->a({href=>"$cgi_url=Gene Symbol&search_term=ALCAM"}, "ALCAM") ) ), $q->Tr( $q->td({class=>'grey_bg'}, "Wild Card Gene Name"), $q->td($q->a({href=>"$cgi_url=Gene Name/Alias&search_term=CD%"}, "CD%") ) ), $q->Tr( $q->td({class=>'grey_bg'}, "IPI Accession Number"), $q->td($q->a({href=>"$cgi_url=IPI Accession Number&search_term=IPI00015102"}, "IPI00015102") ) ), $q->Tr( $q->td({class=>'grey_bg'}, "Protein Sequence"), $q->td(">IPI00015102|Partial protein sequence|Cut and paste into sequence search window
MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMF") ), ); } ############################################################################### # Show hits form ############################################################################### sub display_hits_form { my %args = @_; #### Process the arguments list my $ref_parameters = $args{'ref_parameters'} || die "ref_parameters not passed"; $ref_parameters = clean_params($ref_parameters); my %parameters = %{$ref_parameters}; my $sql_data = find_hits($ref_parameters); } ############################################################################### #find_hits #Check the parameter and figure out what query to run ############################################################################### sub find_hits{ my $method = 'find_hits'; my $ref_parameters = shift; my %parameters = %{$ref_parameters}; #check to see if this is a sequence or text search my $type = check_search_params($ref_parameters); my @results_set = (); if ($type eq 'text'){ if ($parameters{search_type} eq 'Gene Symbol'){ @results_set = $glyco_query_o->gene_symbol_query($parameters{search_term}); }elsif($parameters{search_type} eq 'Gene Name/Alias'){ @results_set = $glyco_query_o->gene_name_query($parameters{search_term}); }elsif($parameters{search_type} eq 'Swiss Prot Accession Number'){ @results_set = $glyco_query_o->swiss_prot_query($parameters{search_term}); }elsif($parameters{search_type} eq 'IPI Accession Number'){ @results_set = $glyco_query_o->ipi_accession_query($parameters{search_term}); }else{ print_error("Cannot find correct textsearch to run"); } }elsif($type eq 'sequence_search'){ @results_set = $glyco_query_o->protein_seq_query($parameters{sequence_search}); }else{ print_error("Cannot find correct search type to run '$type'"); } $log->debug(Dumper("RESULTS SET DATA", \@results_set)); if (@results_set){ if (scalar(@results_set) == 1 ){ #pull out the ipi_id and directly dispaly the details page since there is only one hit my $href_results_info = $results_set[0]; my $ipi_data_id = $href_results_info->{'ipi_data_id'}; display_detail_form(ipi_data_id => $ipi_data_id, ref_parameters => $ref_parameters); }else{ print_out_hits_page(results_set_aref =>\@results_set, ref_parameters => $ref_parameters); } }else{ my $term = $parameters{search_term} ?$parameters{search_term}:$parameters{sequence_search}; print $q->h3("Sorry No Hits were found for the query '$term' "); } } #print_out_hits_page ############################################################################### sub print_out_hits_page{ my %args = @_; my @results_set = $glyco_query_o->gene_symbol_query($parameters{search_term}); my %parameters = %{ $args{ref_parameters} }; if (exists $parameters{similarity_score} && defined $parameters{similarity_score}){ print $q->p( $q->h3("Protein Similarity Score (Percent Match) " . $parameters{similarity_score} . ""), ); } print $q->start_table(), $q->Tr({class=>'rev_gray_head'}, $q->td({class=>'rev_gray_head'},'IPI ID'), $q->td({class=>'rev_gray_head'},'Protein Name'), $q->td({class=>'rev_gray_head'},'Protein Symbol'), $q->td({class=>'rev_gray_head'},'Identified Peptides') ); my $cgi_url = "$base_url?action=Show_detail_form&ipi_data_id"; foreach my $h_ref (@results_set){ my $ipi_id = $h_ref->{ipi_data_id}; my $num_identified = $h_ref->{num_identified}; my $ipi_acc = $h_ref->{ipi_accession_number}; my $protein_name = nice_term_print($h_ref->{protein_name}); my $protein_sym = $h_ref->{protein_symbol}; print $q->Tr( $q->td( $q->a({href=>"$cgi_url=$ipi_id"},$ipi_acc) ), $q->td($protein_name), $q->td($protein_sym), $q->td({ALIGN=>'right'},$num_identified) ); } print ""; } #print_error #print a simple error message ############################################################################### sub print_error{ my $error = shift; print $q->header, $q->start_html, $q->p($q->h3($error)), $q->end_html; exit; } ############################################################################### #check_search_params #Make sure that the params only have a text search or sequence not both ############################################################################### sub check_search_params{ my $ref_parameters = shift; if ($ref_parameters->{search_term} =~ /^\w/){ if ($ref_parameters->{sequence_search} =~ /^\w/ ){ print_error("Cannot have a Text Search and Sequence Search in the same query"); } }elsif($ref_parameters->{sequence_search} =~ /^\w/ ) { return ('sequence_search'); } return 'text'; } ############################################################################### #clean_params #foreach param this script knows about make sure nothing bad is comming in from the outside ############################################################################### sub clean_params{ my $ref_parameters = shift; $log->debug("RUNNING CLEAN PARAMS"); $log->debug(Dumper($ref_parameters)); KEY:foreach my $k (keys %{$ref_parameters}){ if ($k eq 'action'){ $ref_parameters->{$k} = clean_action($ref_parameters->{$k}); }elsif($k eq 'search_type' ){ next KEY if ( $ref_parameters->{'sequence_search'} );# ignore if this is a sequnce search ($ref_parameters->{$k},$ref_parameters->{'search_term'} ) = check_search_term(type=>$ref_parameters->{$k}, term =>$ref_parameters->{'search_term'}); }elsif($k eq 'search_term'){ next; #already scaned above }elsif($k eq 'sequence_search'){ $ref_parameters->{$k} = clean_seq($ref_parameters->{$k}); }elsif($k eq 'ipi_data_id'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); }elsif($k eq 'similarity_score'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); ##Parameters for re-drawing the protien map }elsif($k eq 'Glyco Site'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); }elsif($k eq 'Predicted Peptide'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); }elsif($k eq 'Identified Peptide'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); }elsif($k eq 'Signal Sequence'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); }elsif($k eq 'Trans Membrane Seq'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); }elsif($k eq 'redraw_protein_sequence'){ $ref_parameters->{$k} = clean_term($ref_parameters->{$k}); }else{ # Doesn't allow std sbeams params through #print_error("Unknown Paramater passed in '$k' ") } } return $ref_parameters; } ############################################################################### #clean_seq #Clean the sequence to a sigle clean AA string ############################################################################### sub clean_seq{ my $seq = shift; my @seq_lines = split/\n/, $seq; my @clean_seq = (); foreach my $line (@seq_lines){ next if( $line =~ /^>/); $line =~ s/[^A-Z]//g; push @clean_seq, $line } my $seq_line = join '', @clean_seq; $seq_line = substr($seq_line, 0, 500); $log->debug("CLEAN SEQ '$seq_line'"); return $seq_line; } ############################################################################### #check_search_term #Make sure the search term is appropriate for the search type ############################################################################### sub check_search_term{ my %args = @_; my $type = $args{type}; my $term = $args{term}; print_error("Must Supply A Serch Type, you gave '$type'") unless ($type); print_error("Must Supply A Serch Term, you gave '$term'") unless ($term); unless ( (grep {$_ eq $type} @search_types) ){ print_error("Search Type '$type' is Not vaild, please fix the problem") unless ($type); } my $clean_term = clean_term($term); ##Look at the different search terms and make sure the data looks ok if ($type eq 'Gene Symbol'){ if ($clean_term =~ /\s/){ print_error("Gene Symobols Cannot have any spaces '$clean_term'"); } }elsif($type eq 'Swiss Prot Accession Number'){ unless($clean_term =~ /^\w/){ print_error("Swiss Prot Accession Does not look good '$clean_term'"); } }elsif($type eq 'IPI Accession Number'){ unless($clean_term =~ /^IPI\d+/){ print_error("IPI Accession Number does not look good '$clean_term'"); } $log->debug("IPI CLEAN TERM '$clean_term'"); } $log->debug("CHECK SEARCH TERMS '$type' '$clean_term'\n"); return ($type, $clean_term); } ############################################################################### #clean_term #remove any bad characters ############################################################################### sub clean_term{ my $term = shift; $log->debug("TERM TO CLEAN '$term'"); $term =~ s/["'*.]//g; #Remove quotes, "*", "." $term =~ s/^\s+//g; #Remove white space at the start $term =~ s/\s+$//g; #Remove white space at the end if ($term =~ /^\%$/){ #check for just a wild car search print_error("Must provide more then just a wild card '$term' ") unless ($term); } unless ( (grep {$_ eq $term} @search_types) ){ print_error("Search Term '$term' HAS BEEN DELTED") unless ($term); } $log->debug("CLEAN TERM '$term'\n"); return $term; } ############################################################################### #clean_action #Make sure this is a param we know about #Print error if not a good param ############################################################################### sub clean_action{ my $action_param = shift; #Add all the possible action parameters here my @good_actions = qw(Show_hits_form Show_detail_form ); if ( (grep {$_ eq $action_param} @good_actions) ){ return $action_param; }else{ print_error("ACTION PARAMETER '$action_param' IS NOT VALID"); } } ############################################################################### #display_detail_form ############################################################################### sub display_detail_form{ my %args = @_; my $ref_parameters = $args{ref_parameters}; my $ipi_data_id = $args{ipi_data_id}; print_error("Must provide a ipi_id to display Glyco Info. '$ipi_data_id' is not valid")unless ($ipi_data_id =~ /^\d+$/); $log->debug("ABOUT TO MAKE GLYCO OBJ '$ipi_data_id'"); #go an query the db, add the peptide features and make into a big Bio::Seq object my $glyco_o = new SBEAMS::Glycopeptide::Get_glyco_seqs(ipi_data_id => $ipi_data_id); $glyco_o->setSBEAMS($sbeams); $log->debug("DONE MAKING GLYCO OBJ '$ipi_data_id'"); make_image(glyco_o => $glyco_o); my $swiss_id = get_annotation(glyco_o => $glyco_o, anno_type => 'swiss_prot' ); my $html_protein_seq = $glyco_o->get_html_protein_seq(ref_parameters=>$ref_parameters); my $protein_name = get_annotation(glyco_o => $glyco_o, anno_type => 'protein_name' ); my $ipi_acc = $glyco_o->ipi_accession(); my $ipi_url = $glyco_o->make_url(term=> $glyco_o->ipi_accession(), dbxref_tag => 'EBI_IPI' ); my $swiss_prot_url = $glyco_o->make_url(term=>$swiss_id, dbxref_tag => 'SwissProt' ); ### Print Out the HTML to Make Dispaly the info About the the Protein and all it's Glyco-Peptides print $q->table({border=>0}, ## Print out the protein Information $q->Tr( $q->td({class=>'grey_header', colspan=>2}, "Protein Info"), ), $q->Tr( $q->td({class=>'rev_gray_head'}, "IPI ID"), $q->td($ipi_url) ), $q->Tr( $q->td({class=>'rev_gray_head'}, "Protein Name"), $q->td($protein_name) ), $q->Tr( $q->td({class=>'rev_gray_head'}, $glyco_o->linkToColumnText(display => "Protein Symbol", title =>"Protein Symbol Info", column =>"protein_symbol", table => "GP_ipi_data" )), $q->td(get_annotation(glyco_o => $glyco_o, anno_type => 'symbol' ) ) ), $q->Tr( $q->td({class=>'rev_gray_head'}, $glyco_o->linkToColumnText(display => "Subcellular Location", title =>"Find More Info About the Subcellular Location Call", column =>"cellular_location_id", table => "GP_ipi_data" )), $q->td(get_annotation(glyco_o => $glyco_o, anno_type => 'cellular_location' ) ) ), $q->Tr( $q->td({class=>'rev_gray_head'}, "Swiss Prot ID"), $q->td($swiss_prot_url) ), $q->Tr( $q->td({class=>'rev_gray_head'}, $glyco_o->linkToColumnText(display => "Synonyms", title =>"Synonyms Info", column =>"synonyms", table => "GP_ipi_data" )), $q->td(get_annotation(glyco_o => $glyco_o, anno_type => 'synonyms' ) ) ), $q->Tr( $q->td({class=>'rev_gray_head'}, "Protein Summary"), $q->td(get_annotation(glyco_o => $glyco_o, anno_type => 'summary' ) ) ), ## Display the predicted Peptide info $q->Tr( $q->td({class=>'grey_header', colspan=>2}, "Predicted N-linked Proteotypic Glycopeptides"), ), $q->Tr( $q->td({colspan=>2},$glyco_o->display_peptides('Predicted Peptides')) ), ## Dispaly Identified Peptides $q->Tr( $q->td({class=>'grey_header', colspan=>2}, "Identified N-linked Proteotypic Glycopeptides"), ), $q->Tr( $q->td({colspan=>2},$glyco_o->display_peptides('Identified Peptides')) ), ### Display the Protein peptide image ### #$q->Tr( # $q->td({class=>'grey_header', colspan=>2}, "Protein/Peptide Map"), #), #$q->Tr( # $q->td({colspan=>2},"Sorry No Img") #), #$q->Tr( # $q->td({colspan=>2}, #make a table to describe what is in the table # $q->table( # $q->Tr({class=>'small_text'}, # $q->td({class=>'blue_bg'}, "Track Name"), # $q->td({class=>'blue_bg'}, "Description"), # ), # $q->Tr({class=>'small_cell'}, # $q->td("Identified Peptides"), # $q->td( "Glyco Site Location, PP = Protein Prophet Score. 0 low, 1 high probability of peptide identification"), # ), # $q->Tr({class=>'small_cell'}, # $q->td("Predicted Peptides"), # $q->td( "Glyco Site Location, GS = N-Glycosylation Score. 1 low, 0 high probability of N linked Glycosylation site"), # ), # $q->Tr({class=>'small_cell'}, # $q->td("Identified/Predicted Peptides"), # $q->td( "Peptides are color coded according to scores assoicated with each track. More intense color means better score"), # ), # $q->Tr({class=>'small_cell'}, # $q->td("N-Glyco Sites"), # $q->td( "Location of all the predicted N-Glycosylation sites"), # ), # $q->Tr({class=>'small_cell'}, # $q->td("Transmembrane"), # $q->td( "Location of all the transmembrane domains as predicted by TMHMM"), # ), # $q->Tr({class=>'small_cell'}, # $q->td("Singal Sequence"), # $q->td( "Location of the Signal Sequence or Anchor as predicted by Singal P"), # ), # ) # ) #), ### Display the Amino Acid Sequence ### $q->Tr( $q->td({class=>'grey_header', colspan=>2}, "Protein/Peptide Sequence"), ), $q->Tr( $q->td({colspan=>2, class=>'sequence_font'},">$ipi_url|$protein_name
$html_protein_seq") ), $q->Tr( $q->start_form(-action=>$q->script_name()."#protein_sequence"), $q->td({colspan=>2, class=>'sequence_font'}, $q->table({border=>0}, $q->Tr( $q->td({class=>'blue_bg', colspan=>5}, "Click a button to highlight different sequence features") ), $q->Tr({class=>'sequence_font'}, $q->td($q->submit({-name=>'Glyco Site', -value=>'Glyco Site', class=>'glyco_site' })), $q->td($q->submit({-name=>'Predicted Peptide', -value=>'Predicted Peptide', class=>'predicted_pep' })), $q->td($q->submit({-name=>'Identified Peptide', -value=>'Identified Peptide', class=>'identified_pep' })), $glyco_o->has_signal_sequence()? $q->td($q->submit({-name=>'Signal Sequence', -value=>'Signal Sequence', class=>'sseq' })):"", $glyco_o->has_transmembrane_seq() ?$q->td($q->submit({-name=>'Trans Membrane Seq', -value=>'Trans Membrane Seq', class=>'tmhmm' })):"", ), )#close sequencetable header ), $q->hidden(-name=>'ipi_data_id', -value=>$ipi_data_id, -override => 1), $q->hidden(-name=>'redraw_protein_sequence', -value=>1), $q->end_form() ), #add in an anchor id tag to make protein higlights come back here );#end_table print $q->a({id=>'protein_sequence'}); } #end handle request ###################################################### #make imgae # ##################################################### sub make_image { my %args = @_; my $glyco_o = $args{glyco_o}; my $seq = $glyco_o->seq_info(); my $wholeseq = Bio::SeqFeature::Generic->new( -start =>1, -end => $seq->length(), -display_name => $seq->display_id ); my @features = $seq->all_SeqFeatures; ### partition features by their primary tags my %sorted_features; for my $f (@features) { my $tag = $f->primary_tag; # print "FEATURE PRIMARY TAG '$tag'\n
"; push @{ $sorted_features{$tag} }, $f; } my $panel = Bio::Graphics::Panel->new( -length => $seq->length, -key_style => 'between', -width => 800, -pad_top => 20, -pad_bottom => 20, -pad_left => 20, -pad_right => 20, ); #add the scale bar $panel->add_track( $wholeseq, -glyph => 'arrow', -bump => 0, -double => 1, -tick => 2 ); $panel->add_track( $wholeseq, -glyph => 'generic', -bgcolor => 'blue', -label => 1, ); ##### Add Track for Identified Sequences ##Adjust score to Protein Prohet score if ($sorted_features{$id_track_type}) { $panel->add_track($sorted_features{$id_track_type}, -glyph => 'graded_segments', -bgcolor => '#882222', -fgcolor => 'black', -font2color => '#882222', -key => $id_track_type, -bump => +1, -height => 8, -label => 1, -description => \&peptide_label, -min_score => 0, -max_score => 1, ); delete $sorted_features{$id_track_type}; } ##### Add Track for Predicted Sequences ##### Adjust score to Prediction Score if ($sorted_features{$predicted_track_type}) { $panel->add_track($sorted_features{$predicted_track_type}, -glyph => 'graded_segments', -bgcolor => 'orange', -fgcolor => 'black', -font2color => 'red', -key => $predicted_track_type, -bump => +1, -height => 8, -label => 1, -description => \&peptide_label, -min_score => 0, -max_score => 1, #Remember the score is reversed down below so 0 is the best score and boldest color ); delete $sorted_features{$predicted_track_type}; } # general case my @colors = qw(red green blue purple chartreuse magenta yellow aqua); my $idx = 0; for my $tag ( sort keys %sorted_features ) { #print "SORTED TAG '$tag'\n"; #feature objects have the score tag built in which is mapped to inbetween the low and high my $features = $sorted_features{$tag}; #make color gradient colors s my $track = $panel->add_track( $features, -glyph => 'generic', -bgcolor => $colors[ $idx++ % @colors ], -fgcolor => 'black', -font2color => 'red', -key => "${tag}", -bump => +1, -height => 8, -label => 1, -description => sub {my $feature = shift; return $feature->display_name}, -min_score => 0, -max_score => 10, ); } open( OUT, ">$img_file" ) || die $!; binmode(OUT); print OUT $panel->png; close OUT; } ####################################################### #general_label ####################################################### sub peptide_label { my $feature = shift; my $note = $feature->display_name(); my $score = ''; if ($feature->primary_tag eq $predicted_track_type){ #the GD graph score only maps from low to high. Higher being better #but the predicted glyco score is lower is better. So re-map the score for the image #but display the orginal score $score = predicted_score($feature); $note .= sprintf(" GS = %01.2f",$score); }else{ #Identified score is peptide prophet $score = $feature->score(); $note .= sprintf(" PP = %01.2f",$score); } return $note; } ###################################################### #predicted_score ###################################################### sub predicted_score { my $feat_o = shift; my $score = $feat_o->score(); my $mapped_score = 1-$score; $feat_o->score($mapped_score); return $score; } ###################################################### #get_annotation ###################################################### sub get_annotation { my %args = @_; my $glyco_o = $args{glyco_o}; my $anno_type = $args{anno_type}; #$glyco_o->get_protein_info(); my $seq = $glyco_o->seq_info(); my $info = ''; #get an AnnotationCollectionI my $ac = $seq->annotation(); #retrieves all the Bio::AnnotationI objects for one or more specific key(s). my @annotations = $ac->get_Annotations($anno_type); if ($annotations[0]){ $info = $annotations[0]->hash_tree()->{value}; }else{ $info = "Cannot find Info for '$anno_type'"; } #$log->debug(Dumper(\@annotations)); return $info; } # permitted_work_groups_ref=>['Glycopeptide_user','Glycopeptide_admin',